USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
1997 Mattel Barbie Doll Happy Holidays Special Edition Brunette GOLD Edition

1997 Mattel Barbie Doll Happy Holidays Special Edition Brunette GOLD Edition

$200.00 inc. tax
1997 Mattel 17832 BARBIE Doll HAPPY HOLIDAYS Special Edition Brunette GOLD Rare!.
Product Code: zs9oiLC
Brand: Mattel
Product Condition: New
Related Products
Ashton Drake Winter Rom..
Ashton Drake Winter Rom..
$49.99
Vintage 1998 Happy Holi..
Vintage 1998 Happy Holi..
$50.00
Disney Aladdin Holiday ..
Disney Aladdin Holiday ..
$55.95
Vintage 2001 Barbie Pri..
Vintage 2001 Barbie Pri..
$57.03
Musical Porcelain Colle..
Musical Porcelain Colle..
$59.00
1997 Holiday Barbie Pri..
1997 Holiday Barbie Pri..
$130.00
Ashton Drake Galleries ..
Ashton Drake Galleries ..
$150.00
Vintage 1997 Holiday Ba..
Vintage 1997 Holiday Ba..
$150.00
Mattel 15646 Barbie Hap..
Mattel 15646 Barbie Hap..
$350.00
1997 Mattel Barbie Doll..
1997 Mattel Barbie Doll..
$799.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i