USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Events During WWII October 18, 1939 The Call Bulletin Collectible Newspaper

Events During WWII October 18, 1939 The Call Bulletin Collectible Newspaper

$36.45 inc. tax
Events During WWII October 18, 1939 The Call Bulletin Collectible Newspaper
Product Code: 587
Brand: The Call Bulletin
Product Condition: New
Related Products
Events leading up to WW..
Events leading up to WW..
$25.00
November 10, 1939 The C..
November 10, 1939 The C..
$25.00
1939 The Call Bulletin ..
1939 The Call Bulletin ..
$25.00
Events leading to WWII ..
Events leading to WWII ..
$31.59
August 9, 1939 Collecti..
August 9, 1939 Collecti..
$31.59
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Of WWII Septembe..
Events Of WWII Septembe..
$36.45
1939 The Call Bulletin ..
1939 The Call Bulletin ..
$36.45
Events Of WWII July 31,..
Events Of WWII July 31,..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events For WWII Novemb..
Events For WWII Novemb..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Of WWII December..
Events Of WWII December..
$36.45
1939 The Call Bulletin ..
1939 The Call Bulletin ..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$36.45
Events Leading Up to WW..
Events Leading Up to WW..
$60.75
Events Leading Up to WW..
Events Leading Up to WW..
$60.75
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i