USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Glossy White Porcelain Pickle or Appetizer Serving Dish 10.5” x 5” Server ware

Glossy White Porcelain Pickle or Appetizer Serving Dish 10.5” x 5” Server ware

$30.00 inc. tax
Glossy White Porcelain Pickle or Appetizer Serving Dish 10.5” x 5” Server ware
Product Code: 774
Product Condition: Used
Related Products
Toyo Ceramic Hand-Paint..
Toyo Ceramic Hand-Paint..
$20.00
Prodyne Cb4 Iced Up Sal..
Prodyne Cb4 Iced Up Sal..
$39.95
Vintage 11” Arcoroc P..
Vintage 11” Arcoroc P..
$47.99
New Toyo Japan Imari Go..
New Toyo Japan Imari Go..
$49.99
Cristal J.G Durand Vill..
Cristal J.G Durand Vill..
$58.69
Badash P350 Serving Bow..
Badash P350 Serving Bow..
$59.99
Gorham Althea Full Lead..
Gorham Althea Full Lead..
$69.00
Vintage 1995 Pyrex Clea..
Vintage 1995 Pyrex Clea..
$69.99
3 white nesting porcela..
3 white nesting porcela..
$83.94
Mikasa Germany Crystal ..
Mikasa Germany Crystal ..
$149.99
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i