USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid
Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid

Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid

$49.00 inc. tax
Technique Round Shaker Basket Stry Fry Veggies BBQ Stainless Steel Removable Lid
Product Code: 441
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i