USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Temp-tations Old World Black Serving Platter Tray & Pedestal Server Bowl Set

Temp-tations Old World Black Serving Platter Tray & Pedestal Server Bowl Set

$69.00 inc. tax
Temp-tations Old World Black Serving Platter Tray & Pedestal Server Bowl Set
Product Code: 732
Brand: Temp-tations
Product Condition: New
Related Products
Blue Jean Chef 12
Blue Jean Chef 12" 4 Qt..
$29.95
Temp-tations Old World ..
Temp-tations Old World ..
$69.00
Temp-tations Old World ..
Temp-tations Old World ..
$69.95
Temp-tations Old World ..
Temp-tations Old World ..
$89.00
Michael Cromer Munich M..
Michael Cromer Munich M..
$90.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i