USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New
Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New

Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New

$39.95 inc. tax
Vidalia Chop Wizard As Seen on TV with Bonus Free Dicer Blade Brand New
Product Code: 872
Brand: As Seen On TV
weight: 2.0 lb
Product Condition: New
Related Products
Prepology 7 Quart Green..
Prepology 7 Quart Green..
$49.99
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i